How Insurance Works

Life Assurance Tabernacle Monday Service – 5th August 2019


they all said they belong to one amounts and nose and new and so the snow NBC AG, and are
long, long are the Sava S, PAC
news show us up as a away in a manner stay out of $9.00 as long
as a ball of all the SMS wait a year are said these are SNA say
the old SMTP IRSCOLEY a SC a LSLGLC Clausen said adult has
not been as easy as chanson Les
says way they then says john Broncos are so
long as long, Sr. VP did the
human flesh out of the event name of Jesus 58421433 : a diesel source. 550 mission: are the words of welcome to five with a more
highly those are there and 9:00 AM and
nine and 9:00 AM and 9:00 AM and
9:00 AM and nine, AAA, and now
are OK, AAA, AA, AM and noon GMT AOON,
MAKAMEDNASASISLAPAACSSIEGSLSFAAA
KAARAFISFLAIAAKAEAPNGSPOFINSIINU
CKKLACMASINFAKASAMITN RAFNAILLFFAKAKAAAAKAAAKAKAFAAPAA
ARLAINFAAMISFS AAA, AA and AAA
and AA and AAA and AA FAA’s, La
La La La La La La La La La La La AAPAAAAFAARSIAAAAEFAA La La La
La La La La La La La La La than the K D OAA AKA and nine AKAKADD SPCAMECMALPAFISLAPLASLASPSCODFAO
CENSFSAISECSYSYSONETIAAMFAMFAFSN
La La La La La La La La La La
EFTAKAARSIAA ICAA La La La La La La La La La
La La
RIFISFLERIAARAREEVENTSARLAIAAKAE
AFIAAMLNPCRIAKAMERNA SAPAA has holds a 0:50 85 west of the border points over
more harm other border provinces of the
more who are going: the and nine and nine, the than and nine 99 there the dam and nine and nine sound name of 10 from BC
summarize 9:00 PM SSMITPS and
SFECCAREMAISIAACSIVIFIECIRASIAAA
AIELLIECSIICF A’s that a AAA ISI EIAIECLRI a
NDIARVCAFIRNASARASIFIAAIC a
LIMBER SIAAMENARASARASAAAAAEIARACMIRC a
K a K a RKOARVCRO a ROAAAC a K a RROP I a NPAAAC a MERARARA K a K a N a RRECORRC a K a KE a SARARACLR A AA ATROCAAIRIRAFIAARCORROMOVERVCACK
SR CMERNRDCCIAAKAAKA A’s
AAPAASIAAPAAAARAARACLIONRACFOFFA
AAAKAKAPAA FSNPRKLACLOROMADNAKAKAKAKAAM,
NAKAKAKA AAA and AA and AAA and
AA AA and AAA and AA
FAAKAKAKAKAKAA KAKAKAKAKAARAFOAACIAAKARLAPAAPAA
KALASAPAAPAAOAAKAMESCIONOAA La
La La La La La La La La La La La
P APS AAA AAA AKARLASOLRIRCAKAARLEAPAAA AAA
AAA and AA LARVCARARAKAMFRE a RIL met their progress on their boards golds and never can be
used for Mrs. You know one before you give your progress in the U.S. order that kept
those suits your yard. It also will be in the army sounds and words. It’s been to live in mortgage until the world markets where an
aloha some blood for their peers.
None: 7:00 AM and will open its development system
are intended for Jesus 5.1215129 129 52 Winston MN and the buckeyes if you’re been bought by been
something more promising a plan this week two hallelujah a simple news zeppelin’s 175 pounds and has something
called home and not as long as:
19900 being taped interview work a
couple recently. Now I want it
opens eight and online human bank
comment on one game and nine
assists the homeless and nine, the testimony of a low of 99.99 and now the food and move around Z dow losing in the area
of EP pounds, a screen zoom in
for a loss on this on the CE Salomon is not
real-estate and also use the biggest onto
the more ways presents an 10th of the 5538. While the the open and buy you a man’s own so far as my
view the move as a lost our own the car of 9809 only the
10th hole they are: nine of the ozone hole nine on 180
cents to two 98 movie there are nine Sam is by a rule on through a vis a vis
the of nine Longley a OV E’s of EOB parents are Israel are REES they are some are OMB has said CC: the law: they are: the big three a, CZ movie they hold
meanness slow the long 9 OR2 and on the NT a inch long, slow the
CRB so. This are two Brands OT your
small and nine UPS dollars IR
[email protected] C a RR, and now a OLE
a RCCA and nine: AR era AAA AAA AAA AAA AAA era AM
VAARCAAAARERSLAARVOAARAACCAAKAKA
KAKAS AIAAASLASAFAAASARAAAMEAPACCAAKAA
AARAKA the the the the OS nine
APLAKAKAAARKRLASRIAAKAKAKAKAKAKA
PAASAKAKAKAKAKASRSIAARAKAEASAR, nine of the EAPAACCAAPAAARAARA there there there the air than the the list as the the than the 999 ARVEGED ARASARE 9, as the GOP, AKA CDC DARLARAFAAAKATSRSINIRLAKAECLAKAA
KACCCAAAARPRAARAKAMENNSG said it
bought at a press box: for a lot of Ide loss on one of my soul works there were moments of individual interaction with the
online and he comes in and are needed in the top three big
time off to mention boxes the worst. President and a couple in their visit there be more than 30 31 points . To their time of the city
you’re going to place among the
top with the Russian mir wais bit version is more
people don’t want version the
police version of its
integration are in place of integration if
you do not recall that you wonder: 1 pounds one of
your hands . And on the presidency there
have always treated inside
another group called on to
graduate of us were tightly here
is the foca it wasn’t really didn’t want to
force this error to use the
believability resilience than
one link another problem even bigger
problem. Motion . And that will determine the
voice of the deportees over the
border are you do not deny
rights are you buying meet your
needs o that again it’s so bold people
students to travel in the name
of Jesus earns: 10 date: yes be
the most out of boxes and he
will on the Fritz Doolittle hinges
listening to find out by the
victims movie told a rally of a
legal to number 150 . Two more deeply concerned about this human user happy be in the world of arts in the house of
the more you some dissidents him
and he was glad as we have
people saying that cost: to
their hous we agonize over more than nine
and knew as soon as it happened. And high and there are high and then and now their hair
and named now than they as long
and named now the than ONPAAFSSRONYPSCRIIRLASRENPRSSIEF
Angela RLIONPKKLASAIRSICLAPLARCR
I’s N EIEDITNETIAAAMENNP R’s I C’s L a
KAKAKA KAMERAFSCIRASL era
ERIRASAFICMVELINIL SAI SAI
OAIAKAEITNNTSRLASLASIVICSNPAITER
ICMVARLAKAMAKALPAASLAS AKARL-L, MLNPAPL, FMLN,
NPRKOMONAIDD MMM MMM MMM, MMM
MMM
AMERNPDFSARLIFRESRFELPAAIRLARLLI
AASAIAAIDDARE a SPSRSSIAAKARCL I’s
NAINFICAKAMEAKAMENNESP R’s
SARAF,
AKAKAKATSRICLADNFISLASLAPARLLAKA
PAAAREEAKARA KAMESREFALDARLAKAASAPAACSOASAIAA
MTIAASIAAKARAKAPAARVELKKKLAPS La
La La La La La, La, a terrible for two months and news. In the washing Oslo and other key ally of all
black ministers would obliterate
sees in the works to be you
watch: are we in the name of Jesus earns only
thank you and Jesus and the score 211151 . We’re only there are people or worse. We’re we’re one of the hallelujah we’re a little bit and Jesus and
the food and than the the the the EAPORDCS,
RLAPLLINFAATLASAIAAKAVER ER BB
my house RESTE a SONFISARL era,
one LDAP AAA, AA, EASLIFSAM 1 MAAAAYM a IR, one
NBA, VASLAFISTR 1 NBA than KA
the OECODREETIRLDLESPIRACLACLCNIMBSA
INFIERIM 9 PLASEASLAIACEAINFAOA
A’s MLPAA IRLDEAINF a
NOAACENYRIAAAYMPAAAMRNARLASLASAI
D a courier and 9009 and 999-9989
RELIELPBSAPLASBLESIISLASAIRTERNA
SARPSCELASLAFISE 1 NAKAK YMPAAAARLAAKASLA AAA, AA AAA, AA
AA RNAKAAAASLA AAA AAA AAA and AA AA the AAA , the the than the than AAFSAKAFISLASAMFAAAKAKAKAKAKAKAR
ARAFAOAAAKAMAIAKAFYIAAKAFAAYLDEF
AAARAARAANCRIAASARAFAKAKAKAC ARLAAARAKAA Ira AAA AAA La La La
La La La La La La La La La La La
La La La AAA AAA AAA,
VAKAKASLAFIACRYIAKAIN , and I am not thank you very close . Vote for Mccain was to be one
of the human liver line in your garden
articles in five runs in
partisan and journals and john
singleton was very personal
portal ticket to r results this more to come over
one . Number 139. Their mission.
Austin knight and worked in the
course we are one. Hallelujah suitable to only six months
because you’ve been around since marketing program of your money.
The business end up with. I have
one. As in an early and often
we’re one of the movement of goo . You can buy another word for
more complete want you to watch
on the big twelve’s the Duvall
for courts would be more active
th All but the talks in order to be
the working people enjoyed the
only people with the hourly and
I was even more worrisome for on the the the the the the the than than the the the the than
the the than the DOCE a SIMAPAAARANRRERIISCE a
RRELIELESSNPREECIARAFAFICEARA PAFIACDFAASAI a LLEFAEB a a a
KAFICAASARARE a RKIONFIBEAPAA KAKAKAKAKA was nine,
RICRINETABACIAMTMILLSEAPABINFISE
AILML P’s RCMILLKKIIAAAKA DNFIAAARAFASARAIAAPAABTAAKAMLNRA
FIC a MERIRAMEMAINOAAFICFE and
nine AKA the PAPDMEAKAERCIADDAISIDSINFISDARSV
AFISLLASIAISLACMAKAIIDEAKAKAKAVR
, AAA and AA and AAA BAA BAA BAA
La La La La La La La La La La La ROAAID a VA KAS, NA KAKAKAKAKAAAAKAA AAKAAAAAKA AAA AAA KSRCCRE a RLRATVAPAARAOIELLENTE
a
EARAFIOSCFAOIROOEAILAKAMIAPAAMFA
AAASAKAPAAARAFEAPAAAVEAPAAA MERCMASLAREARAKAAFIBETIAAPLAKA
the level for the use of biting
you buy something you want to hear
live in the new would never grow old and then as the world’s women
who are you always no fresh didn’t know whether it’s easy to
lead the team here is someone
out idea to as the LAN that you have a reporter called
for to them and NASDAQ to number
one pick to hallelujah 182 32 words : I use the word to who and they then move and nine and and nine and the the a and 9999 99999 era OAASADN a RROAS and
nine ERCLA AASMA AAAARA AKLARA 9
APAAAAAAAAAKKKLAKAKAKARANRAAARA 09 and now the AAA VOAAAARAKAF a
ICARAKAAKAKASAAKAAKASA KA AAA and nine
AAKAAOARAAINOAAAAKAKAA AORNPRARA AAA and new food , they said AARVCRSORS AAA ASRNCA RAR C’s ad was a RSA, they are
and now a KKK OROAARCAAAAAKAKA KAKARAAAA O’s E AAA and news,
and now a AKA R.A. Arap AAA than AAA than a AKAKA OEM AAA
and AA and nine AOMO AAARAARA AAA and AA and now a AR AAA OK era AAA are a sense of value working with the value of two wars over one of our minds that are more workers or groups in Jesus was only human . 136. It’s been well as from one hits for more as a one and one sister and it’s only in new revenue for our 389 on phone: 999 ERV 3000
names and IZRERVCRE a RR 9
ninths, Sr. a man named
CARCMAIACORACIAAAARACAAAGIBEARAS AASIAREGR era and now ICAKAREVER a CKAARAA KAKAFIEARAKAARA OAAACAKAICAKAARAARAAREARAKAAAUSA
PAARAASRE a RR era AAA and new and now ACCRE a
RRASAARLARAGASARAARAR ACCIRARKOMPAAR a
MAMRILIAAARAAMIAAKAKARAKASARPRRE
AACIEA and now the AAA than a AAA AAA AAA AAA said C CAOCEZ a RCARC a R R as the RARAARE a RCDEAKAGS RE a K a
KIRAARAAKAARACAKARVEIRAKAMREARA ERYA and nine are are day and
night, and now a man are in the mode of me through this morning for. Voting system areas would you
rule RE-use morning we are coming to your health and you’re missing the city to
be there forever yet come here to three there were no doubt you’ll hear
prince from an area someone coming.
Three of someone this morning
all those. Even you’re going to
stay here we are within a less
safe i the main reasons in them might
seem a month’s uses it. Human progress your human harm would come the New York
this morning in there also been no been in his leg we have stopped seeing the Johnny for three days maybe 883 something back some
1-85 50th before mates I want full 10 Carries
every board of board will hear you’re pretty
high until the beginning because as we expected no update it or not it will be
without the four 48 tomorrow . When the big 3:8 of: did the morning fact we’re going to be funny at
450 AM in a bag of fear anything the same as have to limit its one is 85 and the other one is spinach or amen . The dow one is 21 1st in the scene of an unsafe he knew was called in faith in
me to a Min so if you look back on eight for
those who are speeding the
navy’s if you look at people like it, no involvement end it is feeling the pain and not build all that counts is the sometimes with the state of that’s because it’s your agent after a bout, and that cats deals in the deductible NEA in
the polish all info: 10-exempt
some way it will not begin to all these big, no big bowl end all because we had we’ve
been believes end of the Lorena had it set
somewhere because they then fall while we
all put his maybe his leg is broken because they did it all begins
in one evening big it is fasting and all but the wording because they make sound shows that the new fall shows it
laid out his back 81 day without four it is a magazine PCs that became bats light
possible motives so on and so on eighth inning all eight points
some cars into our board ended than the life I think what I see all it all the news yet nobody was killed 18 Four it goes back at achim backlash in your board so if you use of five who will not go lower it is the lack of venue may be over if I did before that someone we have to 5:00 PM
to five years to five your honor ways look fresh easy because it in the fourth
gallery at $18.00 and 95 and the atlas fullback your we add binary at 80 81 as base back to rule out
efforts made by any 15 team billboard aid will be a removing
all those things that’s the body doesn’t mean so vivid valley until head duel is the knocking out there and a
LAN osbourn radar and other
Palestinian and outback few big anyone name
of anyone may not have lower C. Al made companies in the debris that identifies say
it is as of ballets people bytes that India says Beth we have it
in a line end its support a better one of
boat show a some secret things back room divider and in school so if your flight first thing
you have to limit its defense
work is 55 when you have a scene you’ll be there until the fall
when you live until the ‘the
letter your boarding school in
inner it said the restaurant so no fear anything until marketing
of ethical and I hate you the memo said in lesser 80 IE very act of the 43 5¢ of the four days eight seeded 51 inning day yield sulfate ND one
of end they’ll menace out a penny
fuller big bend of the wake of London
dollar salary in your destiny in some of the public lands as
enormous this hour on the way any shallow end of fame 80 LN of blood from a beginning and
from Tennessee’s school readiness
team these big part of not being in there by the state every one of one how it plays in
our lives and sat bed by weight of one below in the magazine did not believe
that’s bad news you, can you fill out what
seemed a mobile node that you’ll be gone
and the making of no use then
couple of days you while waiting
for the role of the lineup in a
4 any one and 1998 will become me big backer would appoint an old
son and renewal fee has been reactivated physicality and
spiritually in the game 18 for four and so on and so on two legs your political less than a seal slower than the eight life and your pizza least 89971 gallon of being one of the vial
of the middle of something about that into house debate also something but the thing when targets in the way to go by any one thing in U.S. aid
would delay the vote with
Brianna age of 89 is 88 and
Latinos on go on how thank made by that time 51 of 18 here you’re 1848 week bid for a minimum of two big people as they are men
seem that the state below 50 81003888 months of testimony be a part of the cooling: big apple and as they thought from
your body our suited base for about 91.2 bed bath one that led to one 85 team 80 when you are first in your border will be leaving it said in an endowed off as in any
upgrade the money saved been a leg up on the load stout
a renewal fee as any in the U.S. MF will be revealed in Olney gifts 59 in 1010 speedy joint I’d call you when Elsie Galvan no men seem that have
been the Achille when I was having its IE PC
could maybe it’s best to money
he’s to be for im as possible in in banks that these airways on the case for bail on us for
bringing back into his house at all and maybe I’ll be lost
forever because I can see a little sick
for the life of else-although my
fundraising of the biggest in bank sees a want ad would see I
was alive at 20 when I expected the defrosting by false by my father of my father if you do anything
apple menu will cause a new poll a New
York based on someone somewhere
in ended, anybody better prepare yourself
for passing hand as all because sometimes bet that came on hollywood’s stop and time voted on how you
lose the leaves so if you add you are way below it finds that any doubt you’ll be
lucky back below the last thing you one real estate, and always the fact that so bad if the brand of my fun of all that’s what my father- I was out of the game after any
form announced that they all of the
beginning when affected my
faith. The fussy thing I was trying our I was trying a
factor when of my financial have
the key for me at all of the life and is a
delayed the banks may might affect all batting tandy’s his [email protected] mandated by the same know, any
name it after one of what is going to
use the unallowable -hour of need to know that if he
put me in my mind is home in our ladies I remember my my boy he was laid off in it for him if
you pull out the game hour of you in my room anybody else looking when he went out begin our money
and active about PCs destiny boarded him for me 10 on Saturday I love him in my
room out for bid big key in my pockets and I went to my
leg is because of a photograph
of 10 out we have found the navy
still believe it’s also on so they’ve all come back my wife went back over the
window any sender from the devil in New Zealand is headed it out at the act are always one
of the Almon and celery seed and
love and among a handful of
these time film I’ve out and mailed out if he puts me in my mind is more
Myanmar Delphi to me full year of Mi 40-hour mark of
a living thing. About eight or 97 of 10: an hour and a big I got my final of the king holiday from one 8th goal of
being one of the city to me after eating into and out my mother was dying my eyes became lights I thought maybe in the nineties
he will give me four I still get up to the following
day of the doe one is money
seemed message and 1/2 Baghdad made of Enid is not on a down payment on
a one sand at times in the
bullpen if they wait for the
fasting and prayer is all the fate of Hyundai is painful are a small
devil and I’m back and fall league title of best policy if the back of the one thing to me that
that I bought he was waiting back when I thought that my nine 10 when I bought seeing a hell of a known big enough
crying banner I remember and one might find
out was doing some I remember 19 lead Edison no
doubt: he 83885 think it’s over because they don’t you have it
any upgrade it seemed I read right now I don’t know any
magazine all been made 101010 dugouts I can be so I stayed because a fine of the game was any of the fast
pace see movies they’re all a
low as I say his testimony is I as a visit to write a number of
acts so when Elsie -high on with my father in local
people vote in 83 ethnic offing so our name out with my father is a
leader in the valley of the better we might end office space eyeball your mind end of big big
defense of my father as a form of all
faiths bought the CD outbound of 2.218 three eight back in death on the 98th at thinking people come as eight or via
seats and people bought being
appointed as it 218 full 5558. Bass line meet 10883 Bechtel many it is ending knee debate back to the team that have been
At l.a.’s not been done and it
gives me 10 big. I know that it
was entirely by now the Allied because im in 2000 in and out of
the Allied no I said bob is still waking up to
29 people that the cdnow in any
state in a scene of Kodiak of
the solid another, you don’t
know what you’re talking about the trial is not called bad cop not going to be a lesson
sat down at the small guy is not
waiting no effect any other state that a team and he’s he died down the
Pawlak as if they’re because they believe the tax aiming at the ball had a lot of
people have a place in business
a building that can only say no
doubt it’ll be effective if anyb end of the opening of the same that apple is the
one thing that blockaded but
while a stage that bought and paid and Powell
as a religion one of the deal by any one
ballet’s inning, and I don’t know what
people happen until I know it when an awful lot by the same USC ended them all come back and
tell you about the low end bail
me out of past 901 a 109 era
alive the devil elastic any on a double annual state,
county will come to you and he
would anyone don’t believe quite Bernard
Gilkey speaks in because the actor is not full
house bedevil as you thank god almighty fast as
having the part of his disciples outweigh a lot more name bedevil as you I implore I enjoyed out -office is the in the MMC end the one that can be if you become the impact of the
14 missed 12 in a few company airways the
company in the local elites anything out of that stuff back
to this 89 said that promise you
see all of the foyer two, if any
is $4.00, or how I not the name down and not, entails and natale in the
cabin at the bottom of the lame comedy, drama and idea of giving enough that a lot is also yours and arrested at a boarding house bill calling
people had a lot to have a list
of how does not remain putting
people because if you’re a backpack out
to the back end of the coolest
59 in the eye of the product is up to
you and your theater and enter all
that I am far of 18-minute I’ve been all of us
our caller one has been calling on a block
of code is big bet the last thing they get from these days they’re
waiting all day today we know that they
think why people enroll at the promise onto on Bali separate the promise we get caught everybody -8 for that money is on to you both the one you’re talking about 10 NT oats either enter all about
how far off 18-mania has been lowered our
voice sound call not have already met Sally call
the methods and a main bill is dead at the knee with a wonderful big wave of boat Harris envelope of bases in and so if you believe
involved will have to be back if board is somewhere berries
allow end any something because in with any U.S. City that one of the state tomorrow body’s weight and no one is a
money you made 6:25 entries on Babylon leave a 35 live in one of the editing your dignity and that the level
of makes you are not followed become wanted be voting as a bully body like Willie mays 80 soul frosting see this morning because maybe a city William Rhoden folder because it is we’re not going to
be so I doubted on the dow will
begin. The end of EDTA City at the Illini bank that 40th annual of the delay
and lets you believe in
companies in the now until cool any will be coming off in so it’s something they like to
you that the city you have to
review of the road a new rule
out the one not been able to
bring donate you’ll see that the tool of review five,
but that image bets want universal eighth and all these great for
the 299 because it is no defense
companies it is not affect them, leaving
people completes we have done in CMR a sale at 10
and we have seen all the lord
have always done deal gave yourself to him let him use of you’ll be a way
he will use you as I was any city 35 to 35 a loss in because I said a city 80 said
the president will come to your
house alleviates you enroll in a division of CIA in your
house no one believes in the operating in your house
that the army of us let you look for modems to lead in an because it one way to lease a
binding update the sound so
you’ll have to get the big bodies in mind that you allow
waiting fall in your house and no you are waiting for: the entire line few are waiting for boat to be done until house bill Benes you’ll go to the
something to you what you’ll get the better you have to get people anyhow by 5358 Yeltsin and 60 city eight I know our befriended my way before coming here this morning I have to call fifties and ask. To forgive me if it is my have on that night’s
event have to confess it’s 80 be fought, it is more in any and all the combative I know
that I’d get my said the big bodies below people live in the
delivery biopsies been undone someone
seem no denying that about 115 NE in a deal seems outright it’ll become quite some anything less than 80 we are here because of the level editor: mays 15 NFS 1818 from the on levels reasons to
give the fed below the U.S.
seems to be as long as you shall
be as White House no building the red lion inns in
the show viewers who 19 be the winning run will begin as
usual in the pool of a 24 TV interviews and though the
show usual people be the sole
for the mile oval old husband a minute I am not the 1. in the MN Allen less reason to get a seven or ball USC’s eight as skylights be Sunday as white as snow blower baby red lights dim sum this Sunday at four eight eight in the waning and all the
genes he’s active big board of any law will have to agree with the way
to face in the NT the wind and all begin beside
eight bit more of them are three banks if you’re if you have any
band he sounded the one we missile for the mobile van leer has
proven its one state and he signed any case, it’s it’s top eight seeds if you a sense EOB based as an all the formal cuts you in the fifth stop you organize we have to collect toys will lie at the center the best power I say no to be based think by now living with universal echoed ended what we are redeemed in the
bible belt taking for granted and one save a new place you you’ll have to
know that I replace you what he’s saying
is, if not we invited in the final days about 28-19 bob Eason of a minor back on
line all the airline is wrong side of a one batting average. No if he sees something he will do
its image as he said I’m impressed you will have to know you would be
based really a sad anyone ever anything bad about her weight of $1.00
salary in you’ll be asked to
name affect the title with a pointer or you’ll be died in the wake banks people three ended up as I know in the building time that people claim
building until an unremitting you one whenever I have a higher bid on as a base of mouth out
with Wayne as I’ve been in one of the data model of a law
that has killed in the eighties
to it is on my way in the ad indeed been awaiting an
obedient use of its big wall of
their own 15th if you accept the one guy
and you decide to believe other thing is that come in as a
reason to get out if you are battling down recall
drive at what you’ve done is not all faith it’s asking for forgiveness is the Z. Yost is maybe Brian ask of the nineties no affect only you have all
found no doubt what the event is open 10 ask for 4000th 50 no matter how trivial things
on it’ll become quite as snow if you ask if you feed a growing
number of babies you know I said is that have used it in if they feel offended
any better the Sunday before we sold for the month of the north has
pulled in vote on the signs and use of its he’s the one will say the no body contains it in the preheated oven idea to
have seized ended after contingent board has seen its so when I was the other end is the SQL people as seen by the sickness
is based so bluntly warned if I
hear people from the CD is because people you
know their way by which you got
the CDs on some 10. He’s been on the one before
being all your beanie babies any needed on C in macy’s methanol someone in a TV and
even know on a black end the massive and love,
forgive all 88 gained some one some bank board will forgive you anymore if it is a blessing of
the new is a power pole face the defense , both as the defense no matter how a raid it from being callable for you but if you are able to do its that you’ll be as bad as fooled
ended best four off a round at the end of the things that
are needed by a new that puzzle is that kind of
level bottle gives you a few lasted 12 days about
available if you know you about
all the fate of our end continuously you’ll see beneath the things they seem
worth half ruling in your line that’s what the bible think
you’ll need big base from other inning this morning newcomer interface and 8:00 PM tomorrow
until late in the end of the garden fourths of the city
of electing people will die at 50 eight million 58 to 14 more than AAA, AA AA and AAA, nor is it a level with local Isaacs of packets he
15/8 this one: five in those days was.
Sequent. A reasonable profit this summer,
was in 150 and 75¢ below seven
house in order for the 29 on
movie. The clients on his face
was and save remember no pool of IP
60 fire wall before the truth,
the event of a: the weakest link
in a sign on as a player went so in game one of them all-singing
Cole and 06 in the sky and
process them all the goal of the
good father have the right
career I nineties 15 years in a no are off as we know the story requiring basic yes how viewpoint every 10 he will seek MN costing the fact that I said to him to go and then he wants anything that’s he’ll know him he would die it into the bass a demo by sea bass a dollar bill
believes that but I think it’s in this something that I think
it’s also a fake ID number one will
have spoken blockade that being a lower down off in its in the I’ve always seen at lisle beat
up from people I decided that enough I Is notably there was seen in
Martinez unless it is called the
event a set of products weight is laid back as a middle tier is eliminated 50 bad faith that no you’ll be here you are back once a becoming. You then by Viacom going to see the Benson less than a simple that three
out of Isaac any mess. Hunt said remember no pool of IP
CHP our war before he improves
on the part of it, and how long
the averages: my site and is the in the encyclical points aboard see before your eyes only one I need like° outbound thing is when valued or faking your realities
morning the same thing it always end we have the company’s pace with
corn is in the race and all the belief
is that all are all IP CD how can anybody know IDC the how and how will the 48
golds and we could benefit of any have done that would ease
call in and I found as NT wax state then I will save state of the doubt that they are kind of layout 85 or 10 minutes of the net play a pivotal
night’s example of the defendant many delays down 57 NFS eight bad as the profit out of all the
same podium is not yet found at Rockingham bay at his house client bond has already had the
array of all of the summer end of the related I am not going back and have had these play a somewhat seen in a 1985 team not unlikely a definite need that the second
play out in the event will love seeing I walk before being wait till all the back of the things that
the right for you as close any give me another term as a family bought out by the state
bass and all I know because of the play of someone
like you better believe anything but love the same because of the Brea $1.00 bidding battle of the baseball and bobcats and he’s out of his brand that the
outbound in a life of someone because of
the peso’s Brea what about by demo is a high the lobby and filled out that some data that we have
yielded no one I can’t believe
how many calls that never any doubt that he
would I be called acting baseball because of your three high of about melodies with eight no longer
believe it will make sure
everyone by both in thing that you reacted
its nine and given that is a case study
of tiny coming off of the author of the
other side of his own actively involved in a secluded
areas in the play out this
morning contents it’s as IDs are 99993 of state already made the best
against Brea become the model a CFTC them as
eight $1,000,000,000 aid made by men Montana has opened a
cynical and I said Ivan 810 of these
plays build a wall because he cannot get a high state of the plan is a $4.00 base salary roller few not believe you know how I
am with the hallway in all my life in all I had been cut by about
nine days , Mia Hubbell crime that Brea them under the same ease death by dates and water has been already
debris after this one not be
discussed in in the end of going Barbara blockade of the net
profit lying idle eyes by not aid acid on your right back seat of a defense that
anybody can update the sale of
the Luddite, that may be one of solid bodies
and rise the loss of the debris of the 199 to play a bit of a state activities in much of the
fastest thing ended in that you’ll find the buyer on bed until the power of heaven in
every identity that you are enclosed Neah Bay sentinel happened in the midst of a pale eyes on Z: nothing to look upon the
death and a locking in the one
in 5 minutes passed a bill Tilden park investigated by the state
of Illinois and I have killed until the middle of the dollar
because bind them one has ended the day of bob PDT
something that is what you can I we’re
coming to the limit is morning, not the lot is at the Lapin
seemed to be a player and
activities are eyeing the navy, no player has no place people became an easy thing down
by the falling of what I taught at one of the people that the
seeking of them, that is not one
and handed out at about one left in
the 1980 by the little as one in KingCo
Council 58 everyday I did all the talk of everyday the everyday and
outbound of bodyguard of Lafayette bailey at me and I’m
going fine, and I need money Fi NCS had a knife ravenel the
live-aboard a quiet day living
on the outcome people, and remember on the receiver four
for you and I finally asked if the team that
sold out, and stating that flowed base and
the sale of death of ratings
than enough to hold about being that made them of
any of these fought out in all
these little guy in this morning I believe it had not at all you’ll my basement of 10 people are likely be caught dead end of a bet he’s
already have these dates of them
are doing a little eagle and players
asked in the end is one winded end of death was unable baseline 10 he’s faced total SA road . No Airways I leave the week.
Macy you know the way I deal with the
weight of all these plays give me an opportunity them one-out his death still at: the idea on the
compound of making he’s not even get out and there on have any team look at something called plan, I can evade that they update not buy
the products and one not play games and that provide about the macy’s he doesn’t come to pray for you to show you how you know at the seal the NDS one facet of being eased
their honor the dead then it has not
been that we have four games and in the someone like you help me a bad thing the CIA buildup to
profit of ½ points that lasted on the back of the
leg by the willies. Outflows.
All this or call beeline at 901 a speedy one of
the night of the top is you’ll die big as 80 50 in the month in the Eli death and how one is not it
is not a valid ID how they are
made not only look at something he’d eighties of online via it
is no previous five thing no because there might be a big void in a
town like called noble he’ll be at the same fall of the one in contact with
him every day you got a couple of any bad-luck to 505 April that the
law said the bill that plays not the same inmates in your brain 5285. 50 bill makes the death of
something billed as the quality end its original have because big bet that he’s a meal as big a deal you’ve had a file
of in the family’s $50.00 an hour
on threes and was able to click of a hill. Any bad back of the idea of dates in any game at eight 110 below three a you’ll not die he’s giving your feet thing here 15 years in the I want you to have acted this
morning a week something to you here because Eleanor he said five of those 20 nine of factory and as many acts and from there to
lower in life ½ saves them money is going to
die and I believe I have loaded
point he was one of the profits and his landslide to land,
encountered on me and I had the highest play a sandbag copy of the ball mind I like about playacting is seen as 18 am lost power of love of the
body of a pulled in and out of
the mama, how about ideas are the most
powerful lead 18 of dollars S Babylon beta build in the heart
of the money he’s a safety of three out of
state who bases that pretty high not to disclose the all-out the
people of the brain can help
reels and no defense in the no peace in the playoff I
figure road feeder way I did. But the
way in the three high domestic airlines have the same unlike U.N. nine bake in three 1000 operating areas couple PSA
see some that have seen the same 18558,
we’ve become the hour. Thank you and I banged up to
celebrate a lot of big gate of
heaven anybody Mondays at 8:00 AM
against big night to bring the
day that they called me because
I; daughter updates enable them I found out Friday in the
Vendome come back and a 4. 89 on brain you letting them
know from a lot better than anyone bother
them all the latest order anybody give it a key in his
pocket and yielded ended one I’d been one I’d known as the NCS
one we got 89 although the top end relays is like any other any event he then we did see in
his pocket and then made a lot of babies
denied a leading his team batting lead lives at am beau ideal up at Brown’s death
of a dollar dollars I thought I got a little bit the delay was thinking of
the air war ally in heaven be seen
you have it easier if you are relevant to this. If you are productive or because you’ve paid your prayers
are five think you’re leaving
until making plants to pull a brawl, you’ll know many lasts your destiny us the quality any door banks when you’re reading about
yourself and when he voted in Baptiste 21.252529 Betty and only one 8th your death if any team in this is the same hour and
another was the lead developer
did a 68 if you like the sound will have
to be this openness of our Allies you cannot believe in
god because god is love and the
one in IE when IDC states in the NFL game that none other than the event
also wrong so what are you going
to know but I wouldn’t be needed is a benefit evade no
doubt about that it made a lot
of dental, embedded so wait for
each end of the boat does one
see Gaza lassie ended did the best
in the last bit of litigating
employees back that he’s able even a in the arrested off 18.2 and three at the same NT is going to see
if I’m in the racing at the DOS Santos,
and as noted that that is not
the same disabled husband is the
activists gathered his pocket
entertain he’s not able to do
the same thing for 1 hour 24 inning and one of the deaths and all
has waned as the mentally
disemboweled nine dead bodies, no bats, 11:00 AM:
they’ve added to live peacefully
in the lower-allow big bat and
john are dumped about 14 days le client bases that does something end of the trial CDs may be sent
the morning, any disease in the tag says I
love the CCS me at my intended to use bring
invested into that economy no one is able to be paid to say
it’s a good team, but in the eye was before I leave here each of you shall have a fully
has been the lack of game you have
to know what you’re talking
about invitees baby might be invited
me some level in if you have that his plan in one area where they know me
that when everybody all of them
seem pretty but blaze been laid off over a legal
entity because of the week before
parole the ole Opry no problem saying the ladies they have
those are all big Abby and that is, the CIA saw that this I went they have those things. If they
are now seeing the people of
color building at 18 the border Engels Wiley essay about the is not to Buckingham Babylon bills in a mountain of all the
animals that eat in any way I
have read, you know the date on one game at the yield: annual guide that means he’s eating up all
the details of the one states KB big money in a couple couple couple many NMS from sea trials from the Allied cause a deadlock, I’m
one of stainless steel and 1001 delegate and a limelight is
analyst at BT below the one thing you do best run us your name and you’ll be even if you’ll be
that he’s so while in the eighth
until he’s the one made no TDS
in the last one he will hold any lower than base also be a sauce of Palau be
showing face to face as he is right out of a lot of things.
The one hand out for their he’s off the ball at these
lightly with my disk its final
sign the way one can of a line is
because all these ideas I know im in MN highway that leads out TTL 15 NSA no employee was saying they
wanted some Emmys bet you do if he had to say to
people who says the defense on donate our show you that I have
a vehicle and with my dog I don’t think
anything outside of those like a I don’t know you some of them a
lot of them calling a fuel
economy banks bald eagle and so on you have
any lobbying 18 and $1.00 and
this also on the needs of the
people will know eliseo back that your database power banded together the right idea that you know when I’m blocking
a house you not allow a 0:50 1861 9 to 80 because I know people say you
hear how we shall you go to the
kind of any legal the cottages of the ball I’m one
of death and the date of the
lay-up ally is being displayed
out of the power that I’d have come here too big
for the caller might SQL I die on body of embedded in the
battle of bonded they did any of
one of my body gave me a one
view of an IE we have plenty to
o enough power to the oval of all
you into the little bit less time in the face me that these could you have to be showing
what you think they’ll wait till
rhino bit of a big body that embraced
an idealized and as the data
into them back down a lifetime delayed
doing feeding it is a waiting in the
land the big eight. They had
been slated any evidence Friday that the
spas and you’ll hear the noise because am report it to clients did he look like he’s the guy is
president I think I’ve always my seats and all in
something it is-me this evil
maybe that will not be a
standard they needed FA Sandi Otto Brian Otto I know that the last domain I know that you’re doing those
price was one catch us believe Saddam and available in debt and a denim one here and at 8 to 1 hand of the one hand, I doubt if I
made out of and days while I don’t have this morning
bodies nights the way. I said I1 defense as
some people telling me: Bethany
giving up any of the sea lion of sea in marble turf as 1510 more
diverse, I feel of the ball at all began as
a lineup of these you’ll have to
let them know that made out of
one that is not 149, these in the healthcare is the icon of CBS executive of
mainly of suffering so the slam
death but he needs me and our bed at night,
updated, to die me that I know I title at the animated of the
because it eliminates it all have another lights light
is outside the almighty giving up
the lights glow that the bad
blood away some of the sandy
Allen date only help a lesbian I
know because you lie in your copy somewhere
anything that you have a
possible hour show you that my
body’s power is a mobile phone
at the daw informed out sorry.=Is it all
the fine about some pennies and I think of the peel back to no back mike TV’s is powerful is
more powerful than what you already coming
receive the same thing flopping at the same cannot deny
that the latest high -back plays netted until the total when it came as it I would leave the mighty says
NEC is been offended no one out of you cannot know what the time they see all this outburst
by their top rom is badly added when anything else I
know that I thought of another
none of the less so than the
young people from now when I
type o kid in high no another 10 I have in his inbox would avoid soul I want 10 he decided to keep me busy bill Boyer give your name:
do you people deliver things end
of our overall you realize you are the same thing here of the band-like Tony back below the knee and they say below what you’re
talking about let me tell you you’re coming back in the bed if I was in your blaze I
can’t believe bad to be shocked and for you to
know that only one company store will enable every thing that you
can do everything to 119079 AM on
Friday deadline in every way use the employee of the role below the flood of mind in effect my
memory leak into the race is deemed in September that, that draws on the really it’s taken me exactly like Eddie Bauer and is it a part of its identify as I am 80 ~ give out our
anything from the duo’s eight happened if life I had come out from the
PC all I know I guess the fight
is an insult me like editor of ACM wind up costing thing down
780 – activities at the beef because it is
selling in 10 of waking up on a
company that I thought that if
there is a life of the line that
happen so I did at 15th and I’ve packed away as they sat in
Dublin 18 visit our babies out may not have done a really bad ½ Sony
Computer people by the 50 states our caller is the leading goal, if we’re talking we know what
we’re talking about that they face of the office and
you’ll have to know what you’re
talking about ended the killing 2002 thousand
existing all their dubiously to end the boy and his friend came
to me any pony data do you know that my friend in game cents your name to do the people
continue an essay about 10 they said it is doing is no benefit from peace now that I remembered on
the type of two visit our phone companies they do that is
trying to get a ball hard day you in Baghdad that evidently need not
add a satisfying to comment any
doubts the feedback that you are you
one day would come in one case
also be lightweights is at that I want to let you know that
our past tool entry way out of a
look at it until may sound like
you enact any statement late 19 my office and his house is desolate is based in the
house so I am up to wait many digital knowledge five to NT and to bring to the markets in the delight of like 5 to 10
AM to bring it down all the
budgets , and I am an audience for comment at
the end is there I said our bet he’s highlighted as an
impolite and they’ll be playing
the default people have because these callbacks we have we had a team in the wind up the
ball out how ready to give you the ball ID go to the day’s
total: don’t allow you band yield a lot less so that
you have an indoor ally and you’ll die like a box in the same day that would have on the
note the starving your gas. Only selected up a little or no
fewer than nine companies alive today if he’s going to be
renewal they’re likely to remain will decline will be weak
end all but hosted by its young people as he’s bought two they’ll play a I said that is how the needs 51 hour in tiny cuts you see some people in the guess here
that one line of bills that same
things not be how it was very often said
everything because you know that in Philly as you love the Allied
in the 20 Tony I see no I bought one of the unending all I did what he and
his timing out come back here at Brea night when shall be here
if I’d come back, you’ll get my
database to see that it’ll all
be negative if you believe that something -expected until being in in a film believe there was
something they don’t believe any started liking will have the
time in the board is going to remember you already these babies now we have
nothing here will not be done is
made for you and I know please death heels have to go financing for any race he would leave having played for obesity me
know. 11 days 98 5888 four 48th in Dr. Big time babies Whitney ended Brea and the five teams
parcel I’m a pretty if I am working I know that I
know how waits I was when like pulling back to the high cost only
intensified Palestinian City could be a
mouse think that means a mile
away and I do not have done and
I play a vital and I got laid out on how something that people say to the NLRB at all it is not illegal to know how he
and I’m not that what the theme park company
in that he had done its high will seek the city without
anyone about anyone people may not be the ball saying that they made a
big and the laser and a playful
and 10 59 them a macaroni down the back
buffer is so big I believe that your
testimony because that plan that might not have
taken a bath home at the time he lied to
by contacting mapping banks laptop that the thing in Miami 80 and if you drink
whether people not having if O’Neal I am not that we cannot evade bodies and
other liabilities of a man let
him know it’s really eight eighties because of
sickness in coming Bartoli if it is because of the problem although they all three high so the program is ladies at 12-hour you’re going to have three in 10 will rise when we are as many worry
they’ll co 10 file as any account also help but think
of “you’ve got up to him he’s hitting you in in find a way to CDs is your company and I know the last decade as defying for
those kids ID in my face in a
city center 83 cents is that coming into the
borders the day the idea of about 509 lee asset in any event called me what I’m saying is killed and
½ to wait for someone to a U.S. If you really you’ll see them might be harmful
than all of its European in may and eliminates and the
same bit of that product is
called house that the line, we would all you
need it’ll be the name of
italy’s 188 in 10 state and local races in an Seattle upper left corner from uses words of Nicole in the PDC cheap allow his view. CL a crowded areas. L’oreal more if you can this be I think someone will not come
when doubts know if you about the new band you allow bringing your fed by 80 test for a little bit of an old
and layout even the most powerful are false bat board in a pool of Indio
parents believe it’s Brea iridescent and hear any barking play a it’s not open those at the league at 10 you’ll save
all I’m not thinking about idea someone so it’s a one is
thinking about ideas me the
global slump with only basil or online at Bethel or on a toasted beef of
sounding somewhat under some
think you’ll back to leave you
do on a Sunday and all the small
idea did not get off the devil EC you ball flying the land in the late in the polls,
because he know that they already in his house backfield ballet frosting : dial to build upon Santa Ana is fluffy and Tony and
you’ll not know the weight of
the 80 MB Big 108. How’re I think anybody in heavy volume 80 to one game already why am I saying already because your progress defense Tokyo Robins air when 20
points a finger as you outlined a bus
full value of nothing but he has
taken it already on the course but big devil is the name I
guess you’ll get a lot has taken
it on eight of a disabled by a bag of Fullerton
died last night before you
already defend our diet 8380 we’ll be a 15 billion audio will get better life now becoming the deal does all that
bad at the people you about one
in PAC money from because one day all bottled the
kind of a Dallas any oval build me know if you are
expecting a cardiac death is a
live your life to live because President Clinton of
Camas cast, cast out of me makes plan under its in the middle of this you’ll we’re going to break below one of his full 15th Saint
Brianna is how things would not because I see less three of
the father of the save our issue
Braden Howard redeveloping of
things they have a lovely no you’re not needed because I see
the parade bet you upgraded because of a
likely that the song you any one player who bought still
don’t already know it’s because he and other outlet in
the act as if the fighting wind warning of the fleet for
you eliminates either you or another 51 is a lot of money back on a bit of
money and giving the people I
tell you that I’m updating the city’s in 19 minutes than offset the most powerful web: I’ve been
on hold until five is Brea Nam $1000 debt problem is no mind our panel of four days
it is a real sound although at each of a novelty of us a little coding
that you may not know of becoming a member of the ID
safety about his piano anybody that he’s feeling of a SEC some one is offering a new ceo of the fleet in the body of the case of
how from now going illegal elaborate a little
people, because if you see one is not
coming into your life you all
know that now have the land and any of the sound is the one
all the entries and has but one
of the one hand on all told me
that he’s a liar no is not because of the ugly I had
back, and a San Joaquin last
Denny at home for a couple of the store to see us anymore if any of the
NAZI era even had a few
companies like an excellent
journey back to you I think I
have enough that it had been arrested
the mouse in the state is one
thing is Ozzie and as all I know enough incitement is someone who is carrying both believe I miss it from being down about the segment ends Sunday
movie of all the island was something you
have a gun in something we’ll be
back to the audio CD and yielded sat out all remedy
them and filmmaking James Allen of kind of 71 in its eighth we have varying been like a piece of people and we’re bringing to the more if something is going on to some
one we add weight to have him enter
the Kigali 80 are you going to get both for
the AAA AAA and AA-edu or so full gear as we seek solace
before we have 33 on three felony for the economy than normal me a feel for the have always mail are found the main D every
day of the they are , O a R RIERO ERESPRKEZ a YCLASAFILESAIFR ERSI C.s are an AMA ms, EESSCC OASA has an ABC shows, a
NOADNAITIEESIARA ERVCR and ESA IVIAST a IAAVOAARASIERIAR ACCRAFISSIECF SS Jose ERIEAS a
SPIECMAIBERECIARA TLVCRASAICIASARARIFE and add
RLACIVIIAA they made the reacquaint 4388 of a swimming
pool. 10 for all the babies and we had
come your local bus here you go put it in the health of
the no end in all three is I want you
to the victory if any of my scenes or lets you all locally here
might react I’d ask for forgiveness please forgive me out nothing is so I don’t know
that from now going hour before
you in the days here might be as any
of my clients in men back to pull together all
of you he’ll play a game in Sr. she’s accused of appeal of a messy long as I see
market have only a 78 . Of all done enough for some of
the same eight 50 something like 20 saw senior someone in all the mails
in one big apple arrival of the
based on a new one is the
menacing of all the Minneapolis.
Write the Philippines and have fun,
three years ago-03 era for the
mobile, the market, as a senior at the end
of the EPA Genevieve could be
someone else a show all seen as
saying you’ve seen on a power
outag seeded Indiana of scientology
some of the 86 era for the happy
evident in the event of Simi
park of the PSC Mondays, in a
long, the Ira, NOA tittle the five
RBIS, the sun as soon as senior
CIA, the CCROC and needed in the
center line, VP candidate one
ORNS ONSFSC E’s R, OE Howard hunt is
one of the power of falsity of
the navy has a big, BSN
Slovenia, of the native EL
MERSST D’s are TA, Hud, and they play SEC of
the RCMOCIDEFAOFFA era CNN and
MSNBC cable company and
RSCCRSIRTERRELEIRSVGM, so the
RSS a L $9.00, Macedonia, then 8:00 PM,
CNN, the EEOC, a free IR CIO, a
free sound coming on the one
hand, NOAS meeting of the list
and NTT, and feel of a of the house,
the IMS, dean of the apple
defense, one, OCO G’s SEI is a
one OST D’s lee Colvin in sales,
IBM reality of one La Ronde CCR,
Emeryville house they got
married allow the same time
annual holiday the comedy
dollars and a man a C, BRCME to be some others SCEM
T’s R contact dtmf as it is only
one of the name of the cities
are costing them are one of the
d , did anybody know, the one
dated, Kaneohe, CNN and C team
is on a Sunday to the messiah
SCIONSI am a free video of the
loss of cities IBM today, CNN and the
song and the programs at the
coliseum, always, NRA, and
company, and are given a free
and many oth , and one as the last 18 months
of the old law saying and not of
NDS Housing the summit of the
songs that you have SMS, and
thes PP Kennedy at a plant and a day
of the IPO activities of the SMS
CDICDICBCDITNF Jose, candidate
Clinton and the activities of LC the season will be some of the
season of the some of the season
of peace, a system of his son,
Ken, the middle of the database
o to have a C21 NR, L, of the
sunset league, from a final say
on the one they didn’t have the
sat out of the PST i.e., CNN,
PSA up , one of the level of military
of one of the level of houses,
the some are, and getting an
examiner, and Cynthia, EC
although th tough one, C and the tune of
some of the house, 1 FDRMS 1, is
that the time of the flies that
is NETIESDSTRMOCIEL a S a INOISY
d VRML I say, the president, some
of memos, the salsa, he says the
laws, nieces the sale of those
71 to 1 thing on a lot of the en of a sign of the T & NFIS, call
the IRS, Vietnam, CSCE again,
CMEN, said the state to the
plate, and the other, less than
one NF OCISLASER is a city that the son
of the summit, MBAs, the main
reason of the family business,
and some of the summit today,
the because the Sr. team. As they
are gay, 18 dec 18, of any of
the OCR, we have one simple as
it is all that, say the study
showed CNN and CCSETSET, MMR-con, and,
as are the mound, 50, and locate
a good movie RC, 58 in all,
though, are, the antibody, a
Seattl task NTT deal of the hours he
and CNN,, NAZI and Seattle and
losses, the line is, the DNA of any level that are
available, the system included
one of these, CNN, and some of
the MCI, though,,,, as is the
whole city TBD Seattle on the NTT NT on the
TDOMERT, LDLCOMO another, all of
the mother of all visitors are
called to say, S, please, a vis MOC sample of the believe they
are as a whole city of Roseville
might seem all day, oh Lord
Jesus LDAP softly and the REED LN of both safe without the need to come until anything that these without board here we come full anything so you see their wages going will be dying bets you have to no back in in your witness before death berries thank in the without scheme with a noble
anything this morning we are asking for forgiveness before being a lassies 10 hour
in the fifties if we have done something or the
slightest anything we have to
let eighteenths before becoming all those four have a main thing
is we have we are asking for this
morning for forgiveness we know that if he’d come see
things cool things you are on the face to face on
the board will the list of any one of the salon bet you’ll have to be called a
modem, in in so if you live radio in a single new Palo because we at the appropriate made showboat shall hear you’re
brave if you’ll meet your need all the
things you know if you’ll be
walking what I need is play a buyer for their boats of the estate the same if you don’t have either full plate that was one because one of these weighed by one goal is to ride
back to 80 bit of the axes 80° high above the thing is up to one 10 and 1¢ a felon to call any pending a dollar a bag one will be starting it is in a state of warning bodies so one in 10 if you know something then use the line is that if you
do something end the soul of batting one and a prevent
defense Bennett said 80 made a name woes 858 from Maine to beasts is based in favor of Ed B dollar when people had been the same base at Bangor five team from a
nameless form tag that everyone anything that is having brief in a move has acted fast in article one read you said you
would use the leverage of the
soil is pretty please forgive a
scene for the huskies state it out the land of one has given the number of days of racing off may see a and I’m Dave downloaded off Macy , no player selected in so big, messy, below is his back the state is appointing it for them both something by a planet of dead fall may be painted all idle state airline said one had via praise that he’s a bandanna was a top
player is the end of the big five and one day any smarter than anyone else that gets being edited the body are looking for these
they’re looking for Macy fumble by many of the navy’s bond also
have all have been seen for them and
he added via Brea 80 five kingdom react in these
power 14 building bank . It allows any way will not allow one big
10 they’ll rise your office on bag 49 by one vote to oust on my behalf because I needed something I
live Ballou said – not believe I
played on my family migrated the lower back to buying them my way he’s been updated and also allow the
routing NFS copied in July 19 80 was a no no no idea came from now when you
add one after the end of routed the store is the
name any one of the state stopped eating falling. The any laceration below the top knoll ball waits out. The problem to
catch you embed for back to the finals
that no packets from our any allow it to people in the yard at the front of 10 who have been inside you in the caller is three is 10 passing
boat of the reviews continued
back and local fifth avenue
officer I know you do you have
any notes it pros to ask the board is
still waiting until last one involving the planned economy highway made rates on those topics are a big
part of the state may have
played policy of all bases Bilbray a 91 will be
throwing the filets in the apple reality on 88 on a
feast of big 10 and Evelyn
Siegel says it is easy one. 318 8307 was around a lot big pile of dead father would kill reciprocity the elected and you have put everything on a
client not all in all that crime is one of the data
you know that INRA F IS salter made me say that’s what
the one in Valhalla eight, a file a handle the dumping the people designing ended their oldest in
D Wayne need something that is how
I am only as AAA us the lower left the powerful as I
remember how many banks one call
a lot of people that last point is that it’s bad
size allows the city so deadly for employer owning
all had I have the system in the
routing eight 10:00 PM Mondays through their
own team activities by day when the when Allen did you see at
anything back into a cell is
coming to performances of
everybody knows that his boycott
of limiting because a 5415 as well not
everything they had eight in the
number 10 in this one, something it does not believe that power
of the lower me and I am not at the Iraqi left when of the possible no everything will be a key aim in the deli same hell of an owl
sleeve enable the delegate from now
wholly anyone in a DVD demo any sale only line lying NFL big deal, lying on not
letting him time to time left on advance to be asking
anyone saying when the men I
know I’m not lying . We’ll have that assurance if you are talking you know what you are working
out of fuel from now when he’ll be
different from their identities
of the messages of the system they have gained nine O into the
Kennedys be added these are missing they have everything but he added that if one lane of the sat
people are dying off + people,
one of the land, a land line,
then as a patina of them as a valued at
about how Internet on the side exit in any
color you are not the one in because when people walk away weighed
about seeing another novell and
it was a isolated 5 to 1 hour on one life to bush and Kentucky – bred and the
event that unable holiday lighting a nylon believe a nap, Larry
people I met that I am not
believe any of that same because one thing if you will
not raise any hour lead host colonists of
planning to play the USA and bought a dozen us out to
be a solid hour and cause, was
signed a non said breaks that not all of a
case in in a storm in favor of the Exe and a member of the DOS
Palos braves will be paid by
defense has 18 and NT died but allegedly identified in the last one the possibility of any defend a remove the fish in death to the fees eight points on 11 NFS is binding and their own code of profits speed elect of the fish state why people are buying the last
bit of bobby Seale that is not a job as
a game one, because the people I’m not being that, like the fly is one end of
the battle of the knowing that
the lives of the lives of this
as, say people and that’s as good as the actor
that the class AA Bowie of ms-up
eyes, his mother and, of the
U.S. and outs Wiley was saying that I’m having
testimony is made by the patio and our team back to one label, so the one
I’m a dead end of the top of a
safety and not get up and played
as I stand that has long played
ou the annual of a CD of saying I
know that if someone is that the
sum total of them Elum won a one nine the AMA BU the unwanted bills
itself ago this is an editor of the own
faith and yet the CSCE five that
is that the 2000 and eight other less effort and money you look at
what if you’re getting a little
down enemy annual audit of a high from knowing you are not going
to use your money for fidelity
has, at 1 to 1 PM, so it’s I had about 55 this one into why
am I using your money for these
great many hour all states when to the 55 visit to the 55 and one was more for every one of 50 one he flew over and let me in the novel morning
of the fire and he is the call by wire and mail without
warning, the dollar rose level
do is spend money for average is
not. On a new label for that his
research led notes of Indonesian
fields in the arm he is neither
of which the school unless
you’re s the state is not always stuck in
a bill by using your money for something that our panel of
feeding wine the one that offer live is truly for all we know it’s been throwing with driving any one
had no deaths you come to know
about building Friday that the
one and because you disbelieve
becau because you don’t even if they
all died in a state that applies
fought on any one and the Saudis
De Leon panetta, and a full line that power the syndicates anyone dying of cancer and
because you don’t believe you’ll
really died at Wiley one dying of people are
saying people at a binding one died of a tidy I’m a
live video feeds because ID someone who is amazing to me is no doubts that a lot has been awaiting has the same I am with you all after
the end of main thing the end of 1995 memo investing
one of uneasy by little, and on and state after the end of the way they
think we’re still alive in the
one that mean there when of order.
It might see a novel is seen
here in the back as well as you believe in
the power all my PC eight the
power of the view complete he
has a law is so his home in all this all kinds than double the dow was up nine dollars at a innovative yes I am the one one. Any echo Unisys down when you’re
still dealing she said a lot anyone go to market its defeat when that I can do it
because see gonna pull people 15 years people on the last
thing they often end of the bat bats: 10 face me that violence was a walking going to
the markets she beat Dallas in the demo media that based on some of the parking bag when it was passed in the ball outs out in a higher at
50 nine as the kind of level state you live
and leaving the BEI nobody buys eight, is targeted
by a day plus 85 nights the updated by selecting out and
get the feeling of being called
into active, and like a tidy offer
update any update 8818 they’re not being one of the
devil out that you are one of
the day I know that I am a call
that the flying that you deny that, yes and people’s 41 visit 810 a couple it with the stability in line voice because he denied error
there is 10 and big board was
written as imagine I would have
been basement was beaten blank in the house of coal , he or hit the one thing no effect of foreplay for me up at the big play for you and you’ll you
if you live in unusual as the end of the bus I see me
and my house later that the white eyes of the newly
discovered until of these boys have been employed all but it is the name in any endeavor sale marks he told bases about oracle up and named by happened seems
so simple name by thing 15 years was 17 years he’s
still in the missives she was carrying bedevil two was
going to take any Sylvain
redevelop so, but will your case will be different said if maybe because of your company developing kind Devol are
located the NL another hunter was there are no secrets you ended
that has anyone who wants their
little more than eight below its annual 10:10 PM and nine S
economy of a call seeking them eligible after the seaside
to avoid into the body type the sheet it’s kind of Latin because very simple and tortoises ‘night so they see
if you know anyway because you
don’t play you people
incorporate it all at the scene in the
callers asking the U.N. in a
seat belt, said the fallout will end
all reality is one I used to
break the all four days and you’ll have to see one day a
new deadline as the one hand and
a light pole have Macy at no big Glory be too: valuing
more than 20 80 one thing only always seen all
of them here is the data will be
my Lai we are playing in big 1029 USC available through 850 you’re seeing the same way 15 me he felt so by no Italy remain my bones in 80 end of its any cuts me who is business over the homey
from the son of famed easy in a
modem or if I’m lying in landell
Willis 80 at Simi eighties ball and I’m lying let the dividing Bosnia on my
way but the game gave me the NAZI
death of ice and I am because of
giving false testimony back to
the distal I played the defense
ca been as low as Betsy people are dying no
weakness in cities that Simi small boy buybacks from them i.e. the feed bag he felt any of you know the big
deal made at any time we made to look toward our body while passing when im
annual contest for entertaining of the scene in a tidy you about them. Evelyn of state,
Kingdome’s here I am elated to the began on the dow hits you need of the lying around and these babies we’re
passing the if you have the same thing on my you’ll see they have no you’ll see the face to face I can see how you are kind no its it is not a punishment board will pass through 19 32 of every high Entertainment System is because no ID had them any and all in the
application that devil know no borders have stated aim at the way no no about the quality of the main
building a medal you’re coming to big tent has
seen this side of it since becoming a full body adding the
state, Saint Benedict of Aliso
he no what you are reading them by the
state highways out live as being
better if it is alive as the Eli
reading the lead back to life yes it is in your the one with telling you he will be telling them my father was reached in ladies because the sale is 1010 back to the needs if you bring to their bill time you call the intimacy about whether them developed a mule end and a rodeo event of the fields to
11 until the Roseanne so that the Les ballets on a
company that is ending no one any unwanted come so I never had any contact with
the many printing no time in 10 thought whether the line and become my father that if the
weather reliever for please allow the navy had arrived as was the one they
wasted on one end aid of the
season and is already is below sea salt dome, had been a deliberate
and develop a lot of building
one of the bill allows always
been the prime feeding back at
the PC have you told us that that’s
a negative ad enacted a mime and I believe
that about your text and pull it
out until you’ve made your bill
172 and a fractal rates enough
for are any less than a full listing
let people know that have
another cost alligator end if enablers in every way sold by 8:00 PM Aussies PM on king and my father asked at any point
in the stabbing 15 10 belies the brought down by
the end is that big breath in the
bottom of this fact and giving gal as a solo one banner when my father although
he lost in the end of the happened on dns gateways body of a nose at the end people say about the Palais:
either of you all the land a
lakes in the lobby daughters, a , but it is one of the synod of a man S base among the more limited than
in message of some of the past
days, and from not knowing they’ll be
the case of a litigation has, S-TV, so when it finished on government has a base defense identity. So they have to use another one NFC wine avoid he’s sold out they say no: it’s the best of that it was 11 call $1.00 -a loaded point in by the same his bag of ice cap
and as you live in south time in less in the busy at the high on the scene wasn’t getting the audience pointing and while
coming so many of the mop for the five make this a resident of Temecula by the
people involved in a facet stated 10 employees based 80 historic moderates get a rating of 1:00 AM and that a lot of heat of the 1980s, fielded L.a. one CAA U.S. U.S. Bureau of the dump all my mother were the same area link pay big hair any woes he stated he started by the state aid because he’s the he’s
stopped him now reporting going
to let a land of the items averaging-50 810 he finished printing in reviving only 10 on went back
home employee was the end of tonight’s ended late father he was beaten by tearing the bodies of the fact that they thought in MSDN end the advent of lower gap CODELCO he’s less than optimal brought a flood of fame bad about one of the lower than
build a TV debates, download a lot and what they’re
paying, but the OS and not his only son
of Allies, the NFL’s annual
yield you allow animal that is a flood of round ball
landing of the offense flying why one by La Salle and bite out of
the 14 that you’ll not giving
the Beaumont not a lot I have
done the same buyout only the minor any bearing a barrier for activities
and I’m now begun after I do have one in the backfield back
stating that it is like the same
of all of the people below that
level colors to have a client may
prompt the DNA back if our board, no needs a raise dollar limit board until stiff penalties are being that way all state stop it back playing one also is
did not become hello destiny and you’ll see him
walking by fall see them unless they get
from that sender albeit the end
of school for 80 he did on either the death because all these obedience the line of floppy and they can an opening
of a life of the U.S. plays a way that is a brave of the brave mail at
the same end-all its basic reading them when I look like a big hair believe the men rose came far as to believe that no one was coming to BTU
you’ll have diluted it was
important because the 1980s it was on the state because it was only
intended as a man and the eyes baseball Lacey, I’m not sure how when Dan Monson of their orders
for you noticed of people haven’t verified eliminate their aim was crossing devoted
and avoid the one about his death row in
on his face mime in your thumb: buffalo said no money involved in the van and I
did everything but I couldn’t go from now we’ll respect the
senators Boren is as as evidence does in the name of the vote results
he says rose baseball and it’ll be manipulated by the plot Y , AAA AAA and AA, one of best
allows end of the man is a
disaster, made only that but you
deny that of the one that may
involve because they like the way to the
people I’ve met, and fake bombs showed them down
the half hour bags find that 118 wave
Alexander Powell I said, was
defeated that is why are you so you
needed a power has all the dismissal of New York. And again in Ghana is closer to
make as big see one start the fire has said
something that still mail at no
time and I’m one of five from
the one who money made one the end date on the boys and so on until
about two and still node under you know what happened is open as closely as no summary of eyes of some young
men in their intensity bill where what seemed a bit fatal: 10 at 10 in the bush you’ll ever get used
to go before fully at lining the board and
county 10 Indian for that elicited with 10 lead a normal lobby at the actor
Keanu Reeves as a small gain any of the audit given that was later found endless tool menu four role. She doesn’t know that is because
of enemy of delivering when it ended in the portion of 8.8 in the Fosse and see what happened back then she’s our big guys elaborate tale of fly at the end zone, the endeavor buyout bands of that
total is the eighth and live based solely on
the menu that I have not been easy and all but
one that already did that handed
down as one because of his body,
as the 10 people listed on the Allies
live over and other happy call model of the you are making a satellite
aboard one of our asset base that police as
automated mailing a big deal if
all the things based better, not even close to
lend not so big as 1059. All these
believe NT because it is some of
the end it becomes eight days so I
said bill and Betty like how we met our boats Del Amor of data company because they have tax one unlike big money already begun a state was in the beta tau Cassidy du
Soleil does not mandated ending a day when bands like ended entities seems so it’s
been a top 25 visit when they ignore it also more deserving of
return from state that 50 back to wonder why the story. Right anybody that’s the end of the
mob when someone packaged the one thing you $1.00 and bad one bottle Les Encino 80 did not deal on a
knoll annually on data that the
data and the legality of asus
80, and that’s a lot of A USA all unlike consider the Palau become a favorite of the policy
was an eight of the magnitude without a raise boys to lead the board
would be before the defector the
economy is no end if it comes in 15 people they went away and Allied yes because of patsy in the senate
vote on a 91 easy . As 1.8 but what about the guillotine in saying that what god wanted a wee and NT 50 people have done
things I guess you make shawl
backfield called for a full as U.S. Mets all makes all that anything that
they will not see you may
download Shull his power the ease from that date list of one lover of activity low a few ideas after a battle mail
and anyone until the because you know that fire is
the global 818 you’ll be hosted by lied to them at the U.S. A main backboard from no I in no from know he will be leads you
has defended the blaze dolphin team from the late bob Dole and
update of the others opposed to
doing knoll not if you do not
know the deal killer of the three less rate of mystical level bigger receive a level for your of things of the one made from this 20 full of 2/28 because a whole and he refused errors just over
10 and no one would gather for
the U.S. Senate of no small Lake
Elsinore and with more of a new are also lots of you: easy
homework when you fear: when
your favorite has the solution
of your destruction of a while
we were in distress and hungry
school record for the bears
Shelby: the aroma and some
initial Sydney area of the show
more foreign 5123 because he felt you were . If they are based in eight gave you a rise in it for
granted he’ll be waiting for your big
payoff your soul anyone trying the same idea why it also would allow
until the needy a remote when you’re here, any event will run defense
companies was a yield enough in
effect only little drive you going to try you think I’ll wait because I’d underwrite you 10 years 80 coffee nights praise inner thoughts of the 15 I think if you’re asking me and my ways I even you , one below one ended Sunday evening to you is help you like me and my land,
and you face in the police and ban all asked what the man he
wants a guy like me and I went out the
new deal that I’ve got enough
you’ll we’re here we are coming into
play each of us have to know all the
points in the bank until they got a lot
of them might be a thing that I downloaded little
house on line via that’s what
I’m seeing because I: 10 yeah 54 state because I have: any
issues I have played out my
heart and no one played out and
Betsy have set out below on Lycos and 101 of my people I’d also win of acts your
comments he a remote when you hear comments by any of the Internet as a
solution any of the saucier coming as one
who leaned when his best 10 unleash the
Mets open you’ll then sounded caller of money
back alley not a loser based on seek me any bad be somewhat find me fought big formats big hit at
New Orleans ending of joe’s they feed off
call eighth is done and like any of the patent is allowing a need in the
British in because you did not kill the fear of
vote 80 that said that the news as
detailed as a hub of the lower
on saying the deal of fighting the 50 eight million in all I know we haven’t run into
nights there were maybe some of the Liu: L.a. because you are not eating
there would be no more cynical
when that the one he’s so the way your foot off the city
is spending you know it’ll stop any knives elicited from on high
salinity is that bad a couple pointing to complete these 30 days parade Sunday night’s because you lost its way back to one in
this show working on shell if he will not cause of the ban
will ask why yes in the same is not a Federal there is a bond of NDS better
one, and 10 no delays have decided big Gesell stay here three and eight other testimony , 89 state my father is a message to people you still
have to keep people you’ll see
some one else they’ve done is come up
from his node use any kind areas that have it done we know it’s in the navy’s biggest gainer rapids and so on bill died in baseball as endpoints funded by 10 and no one four on the disk to lose The CDA won only as band when Adam was down days at 80 death from 10 and up to lead
best known as eros for them 108 or any of the bed backbone of hundreds of many
guns in death and illness: 10
know if he’s he’s meets the other 70 bad they yield tumbled out of
the people build late as 10 and no Bulgaria : what can be no one can deny the node at the
fuel pump up in the wake up in
the morning in a lot of cool wash your face
so they’ll put all the idea that he’ll back testimony that the illegal sale of its outs in their office for because mexico’s if I am the one always been to
kill you a late start of the rustle four
know if I’ll leave upcoming ballot for now because
you live in a row that someone
has done something to you one seed catalog, in your house to watch your faith that means
you put your hand, those Ten Del sol for mayor and a 21
bridles that coming from you’ll
love you, what happened is a big one of its bill as a battle be coming out
of any light buying my head
because these are of a storm
that brought you made any level bills and on asking the NL same
time wisely and cannot lose a
lot of big cities each of the back is why you’ll get close
enough to be there when of lucky
you cannot believe this
organizer of the 18 stop a mind like big said he stopped
for my father fought with 11 lied about my father brought 50
jumped 18 in third in the depressed at 1050
post at the end of the 1.19 888 on the fourth back into its plan my final cut in the morning device for him not to its state status last thing mind are not licensed by a few listed below borders gets you into the airline safety and efficacy of
the people that sealed case the body, yes Endesa one unattended bags 88052 companies
you’ll still be a bath the list below my father but to no one at my father and a line in their zeal air at 10 08 era in his faith based company five team for
breeding and I won without the
one I know from because one council is on the
big top end up one lasted about worn a lot because after that
and their big they’re also for PC NDS is very cool , a stop the one day have made a five day before because he knows he’s a little
bit and byte caucus on some
people in the morning after battle of
the game and not the end of what he has a big eight Sunday
night in a close enough to be found in a $10.00 debt
down that leads some slots in
one stall and smaller because
he’s the joint at the level of became
independent in seven nothing of the camaraderie he’ll never be as tall as he
even if taken in the one I devised elevated up end up in the code of the full of one fees over 80 my father haven’t eaten the
other than one dissenting five team embryos have to be
there at the NEA Del a lot in its outcome as the ballet by the 1980s. Thank Saturday from one 8th inning no footnotes them, he has been a key house at
that time, not something you
think the data that he’s not getting
my thighs marketing battle of
limiting how can a one stake a
deadline of load and one of saying one is failing ally with these
people, the lower left hand, a dell and
let basil and the downhill flow may detect the big 109 played
out and no one will kill you,
and 81 black and a company that’s
your money is to what I’m saying that if you would if possible
motive as a caller made a 97 in the present an idea few
people whose high before it bad that they buy five no: no one and one started: somehow because he’s now, and I did
there at the intimate anything it was. There any rule PM DEM one is buying in the half 1011 thousand of the blind eye
of the land of that and add the ball landed because he
not been updated the funding of
the destiny of marketing. 80 end of the nuts basketball one is meant to the
back as long as they head out of it I
have not beaten and seized by
these anything when he came back , a leading designer bag that
life is the bottom of the
midnight oil a day and evening
by our guide the ballpark that he’s troubled all policy via because of the-eye view if
you would I know if anybody’s
defending your type player but
they are like soap he said let’s all that you
didn’t build no idea after a young people about the outset in the 14 bad, so played too late, is the
day’s best one of marketing and
gather all the sobre the Donald 80 Bethany had made about the same time of death by Neal, CNN, the flight packets
body of the island has an AAA lot is the latter 11 doubled, and 85 before you go live on all their knees 95 team
without knowing there is a light
is nothing dying out $1.00 and a file on the device,
leaving the net at that time
today, that one, and then you use my file their death rate debt limit on a team of 50 of the bill something of a reckless a
lot of people they did a little
white people have come on line
of 10:00 AM one of the people 50 below underneath I wanted in the
mind, the timing is because of
your number of illegal thousands
of because the line is that a tall
tale of one of the identity as
an M.A. ACA and talking about the game how people get bob made because of a new node is one that mean you do
if you’re a spec called the list could call you a break
below rate that made the same powwow will
be productive and you because board has been as big
bodyguard he boarded a decent young anything better Monday all of a
pointed out the back if they’d
use a boarding house bid on defend on the dow went on a weighted some one please come near a road
map to Libya was effective back, someone is pain in his
house starting time annual
income of 18 back of a downed and the one out
of the last 81 way I had one is
quite a violin dow has the Ica one is fighting for you in the
house all I see testimony end at the least he’s fallen
leaving people are given last one is morning 10 we have been debating high
cost in excess like ousted
Afghan end the blockade that he found he was having a pineapple are no
other area 1010 cost base so on 101 people know that he’s
beating bill and police found anything but think that they
made that kind of Zen of the save of the L.a.
County state alum one egg as easily to you
all entities while the ball out
of the deal is the address is planned as a Benedictine bid by novel coffee has acted within days of any whole thing and
that, the day and at the debate, saying as they have a net loss in the
house made the finals may become a
bill giving that one copy and I’m been
delayed by leaving the house and is defended some one was passing a sudden
end away big hope for the coming
fight anything really sent off
to live there was a young
people, we have a double plays like an
elevated at one of the ball the
way that I have no idea, but at that time, but that the eyes
of the downgrade what happened is that please
possible forgive us what happened we asked only all pineapple any
of the UN Dia and we acted only as a top
pentagon analyst at the end of
the NFL and the 50 someone seem in math and not the
U.S. ally, and at the end of the
online I wheel at the CNN Dea
has been named AR, one of you, N as soon not investing money in
the current you because you how
big the one you have the case, the rising tide of gold . These three days your benefits of these babies are any we’ll be
dyeing you’ll be weaker big
bowl. Both of all rights met this morning on big 84 as
anyone know where to move any
doubt until the batteries and laurel board a 17 to your 10 I have someone come to you a state by
that column one is for Knapp
also has stuck in part from your
house staff team these and other so I guess you’re not end up
dead bodies calling for the
northern end of the dissenting
ignore Nazis by invoking a vote
that whe the U.S. Debt ceiling of one she was dead
bees can live many fall city and bad about eight was also the back when I landed he and a CD called made a big
pot ease in their present these useful to be online no 89 we have incorporated their way I’m giving you the
thorniest and you’ll have to
move my ones on the own death,
and nine and MMM DS Howard MRVA
and eve BV Valley and now as we had a
raise of the menu and new song,
only a U.S. COD and nine and ask
for forgiveness asking bill
Healy a team of the times you only one
LDAP band and STOSUSCMERCAA let
us know that a steal and nary a
soul and 90, he is someone is m and not a love and nieces and
Natalie ABLTCAREOCSARE a CKERV
AAA, AA and AAA, AA, and knowing
all the activity as belonging to S, the same values
and 1981 until 1998 S and giving
zero and nail of AMD here we are asking for ms and NS,
lying as AOL, and CNN and nine
A, and at City Hall and nine,
and that’s a load of the au, and
AGA K , AMR DNA and 99 AM till they
are and
Name and olives, and I am,
around 9:00 AM, one days, and as
Andrea K: EAAS, one is that an A the one last caveat would see
them as AAA, AA, a loving, MA
zero MIAAS a TE a R those
lasting and news, one always
needed ECS made a small, one of his era to
1:00 AM a deal after an SNA, a
one OASUSCOASLADAREFAA, some one
AAA & $1.00 MALCS and new era NR ASEAN, UAA and now the AARP and
knowledge, someone AAA and say I
did not, and AAA AAA and AA NYSE
AA AA AA : E, SDAAEC AAA, AA and AAA VE
BBC online AAA on the ms AAA,
AA, AB Fab of an ASEAN ESA as
the minor leagues , as a model, CABCDARAS and SNA
Sandoval and IE API and CMA
ZMSMIAA, La, La an SMTP, SA
reality, AARASAKANTSAINFIBIN a L AA, NMITASMRAE, MAAA, NLACSOAAAR
C’s am done a lot of and need my
IMS, a live audio CDs AAA, and
AMA era in 90P1 BCARSVA because AAA AAA OTS and none of the
people and knows whereof he ran for 99, one involving me and
nasal old and a PRC 1 a one MB NFIAA YMCA, an
era gone out of the SNMP NFL and
NBA, DBA SCE AG, VA Ely C1
ETAKAS and the DNA
APLAKATLVAKAPAALPAA an SLAAM, VAAMLARLASM 1 a VA, &
AAA MSN, AOL, M.D., and a day,
and the sale
CAACAATVKSROASLASINFICKSNYK,
VAMILEIAAARCM 1 AM AM Et La, La, La ASIM M’s S,
MAINFMLFFAOCARAFIL and M. Rosen
La La La La La La La La VE ACM
MMM MMM MMM MMM MMM
DONSSRCAASIAARES SIACLCSASMIACIAAAA MMM MMM MMM
MMM, M.A. Hanna AAA, AA AA and
AAA and AA and AAA, AA and AAA
are using LSD of the NFL , La, La, La La La La, La, La,
MMM MMM MMM MMM MMM, MMM MMM MMM
MMM MMM MMM La La La La La La La
La La La La La La La La La La L La La La La La La La La La La
La, La, La
RVANPAARESERYSERYACRIACSS a
CCRCCARF BC, AMD’s of MSN
AFSASAS NMS, SMS, SNA ASEAN to
ge AAA MMM MMM, IBM AA and AAA, and
I am an ideal of a AA and that
is not an Ai ado Annie NSA MSAS
8:00 AM CNN, and not in the data , and a CD of the AAA and the 91
MMM MMM AM, EARUBISS La, La La
La La La Ana AIPCAREESLAS, MASI
A’s side SNA and not let the kids and an
AAA bodies, NCR AAA the time,
and dale AS and S AA and AAA La
i.e., L.a. and a lot is 8:00 AM
an S and SIAACAAMENIMA as AAA and
AA, AC AAA and AA
FMSIAAACAAASAAMESLOSAINS a AAA
that a FMLAKASMIN a M a ILM , 11 in CNN annually La La La La
La La La La La La La La La, La,
La ms, one AAA, AA, of La, La La
La La AAPL an ATM and of the ad MMM MMM and MMM
MMM MMM, MMM AASLAKASLAAASLA AAA
AAA, AA AA AA and AAA La La La Palma as CDC of KLM nine
NFINFAOFIBESIISLASIONI AAA and
AA, Ira, an IBM, si and am an
L.a. U.S. and the
EAAGCAAAAAAKASAKACCA AACSATSAKA AAA AAA AAA AAA AAA
AAA AAA AAA CSEA AAKAKACCSDCICBCEA P’s Leigh
EAIMBCAAAC and DAIDECAMESICBCAI RA AAA AAA AM EST AAA, AA and
AAA gaas CDMA ASIACCAARAOAAGS SSCESDSVA and how AAA and AA a
MENPAAMESSCEMADAIAAESSMAMLNARAMF
AASAAAAIS AITCARACLASCEAILESCTAIRSIAAAAF 1
NF a IFISLA NMS of the AARP,
8:00 AM EMFSAINS a NTIAMSOS ASAAAASAECUSSEAAAAAAAAASASACLASA
PLAPLAFIAARACMAICAGIFILLSCENTIAA
SREECSAEPOEAIN La La La La La, La
AICKELACSSCAAATVASCAARASAIDEFAAR
ASAPAEIA highways and so that everybody
knows the am going to last 8
minutes and eight CSETA and the pop out on a ms,
than as of 1989
EGREEAINFIMASASACMAKAAACCAAKACLA PVASAKAKABATE a S a
IAAAFIAACIACIAAAASAIAISLAECMAKAA
PAAKAIOAAFISLA ERVAKLAKAKAFSAKAA, ISO AAA, AA G
AAA, AA and AAA
SEIAASIIAANOAAAARLASII AAASIRNARASARA AAA, AA and AAA
AAA GAKAKAKAKAKAKACAAASOAAAAAAGS
AAA and AA nine Nissan in annex a lot of money are EDTA, 9-998 , LA Salle and my name , title is an unwise PM the
night of the mail, VCRs and 99,
an L.a. with the FAA came a G we have made the plays a game in the call log live for the braves building an optical no lack of all employees any actor has come there MY 1 is
anything that may mean I’m
defending the money I already built and a lot of sand, and only a a in the new array using the L.a. law and I
know flow ES 103 is MLOMO RESPCKOPERIISPNMRVMISLPAASAIRLAA
RESLASAIRAFIAAAARAFIFIBE La La
La La La La La La La La La La La
La La La La La La La La La La La La La La La
La La La La La La La La La La La
La La La La La La La La La La La
La La La La La La La La La La La La La La La La La La La La La
La La La La La La La La La La La
La La La La La La La La La La La
La La La La La La La La La La La La La La La La La
AASLASAPAAARAFFILAAKAKA La La La
La La La La La La La La La La La
La La La La La La La La La La La
La an SS S La La La La La La La La
La La La La La La La La La La La
La La La La La La La La La La La
La La TCI AAA ISI La La La La AMA AAA La La La La La La La La
La La La La La La La La La La La
La La La La La La La La La La La
La La La La La La La La La La La La La La La La La La La La La
La La La La La La La La La La La
ASEA IAAF La La La La La La La
La La La AAA AAA and AA and AAA and AA and La La La La Land and
at one of a game and TV AAA AAA
AAA AAA, AA AA and AAA AAA AAA
AAA and AA and AAA AAA AAA AAA
AA and AA and AAA, AA
FSNFIAAKASAIMADN La La La La La
La La La La La La La La La La La
La La La La La La La La La
Jolla, La La La La La La La La La La La
SFISIAAAAAIINFISIAAKAKA L.a.
VRML La La La La La La La La La
La La La La La La La AAA AAA AAA
A and AA AAA AAA AAA AAA AAA AAA
La La La La La La La La La La La
La La La La La La La La La La La
La La La La La La La La La S FSAINFISS a NN La La La La La La
La La La La La La La La La La
AAA AAA AAA AAA AAA AAA AAA and
AA AAA AAA IDs AG La La La La La lie MSAS La La La La La La La La
La La La La La La La La La La S
AAA, AA AA AA AA AA AA FFSO FISLASLA La La La La La La La La
La La La La La La La La La AAA
AAA and, and a model of Aba if you know he’s back on the
field Santa Ana and rma movie law saying they did as
that of Andrade Daly was the MN AM you’ll need a lot of things you may live
A baby is born of as being of all many , and in the weeks to live here are their own TV see you and name a new ball near real rates to be ideally average of three men of all , leaving how CD Wayne TC Lindsay VOL , sounds in any event log houses
three as (810)-990-9099 of them by Elliot
bodies of 50 we know that involves a beaming less need to give a team
that there all the one big for
him go outside of Brea be no one
could come out from the spring a nine fame you’re seeing these ongoing farm field last e-mail
to one of the end of the Santa
Ana MENY AMESD Sams and name was
unavailable as the NASDAQ of
Seattle is that none of us easy
mark and nothing of the hands of
the three N1 era and I mean and nasty of
money in a study of 189, the type of the NRA sat on a
novel and nine, and not, be
saying they have not seen as a
reseller sending them to be a
CDMA and n jet lag, and knows anything and
New Zealand none of the Saudis
in and near me an example of a ESI nine, e-mail he’s Sami a TZEN 9 REIENRDATMIAAARAFLOSCSTMILLEREMA
IDEAKAMITAMILLOSTSEAIAIARAFIAPAA
AIAAM IFRESPINOAARAFPAASIIRANIIAIAACSC
MAIAAKAAKAMIAAMILCACIRLAREAPA
A’s Mia AR
EAIFAOSCMVAIAAKAKAEIAAKAIACAAAKA
KAKATMIAAAPIILCSAIAAAKA AAMENIAAARVAICSEIAARAFIAARVATLVM
ITSEIAALAKAIAAEIIAAAEIIICA EIRLAPLAFIAA AAA AAA and AA
GASAIAARAFAAKAMIAAAIRAFIC a
MENIAAARAFIEAIVMIAKAIEFAPAATSEAI
A La i.e.
FIAAAFIAAFIAAICFIAAFAAPAFIAAAAIA
AAAFISTSEIAILIFIAAAAFIAAF a NII IC a SEIRNAREIAARVMIAAAA LLP SAI
SAI SAI SAI
LIFIAAKAPLAPAAAEILFCSEIAAPAAPAAM
ENFIAAKASAEIAACIAIAA AKA La La La La La La La La La
La NEA IAAF La La La La La La La
La i.e. Mia La La La AAA IAAF
AAA and AA and AAA AAA AA and BB, and the FAA and IE La
La La La La La La La La La La La
Mia i.e. Ai La La La and a La whom did you move from mailing ad did an army men who are the new our noon, and new human genes else is on line and misuse more . Jesus as serious burden to more to win 100 of the reason this one’s for you and we have all this mean more of more use of America. Even in turn wanted to race or one in a resort area . Some are more reasons. 60 according to the far edge of
the children of his of storms and an said that you’re thinking of
people somebody once five with two was to bring fire from
what human an idea when you have much use and worked one of the Marches were cool use among them said Friday for working more people will see fire to be
and we’re in for lieu human reason reasonable home in a few few prisoners of
war in your life . The Spartans more than a AAA, AA and nine three . No and we’re going to be here for
use only used the knights and for these
regions. In the morning of forcing more
emotion of service and tools to use of the the line you sent . Use more of workers reared it’s an order them or use tools for more of an inch of the Service Post System . Nor is the winner from and to call for the right thing work of five in for a whole new to where we’re going to have a
persons who were moving in and Charles and sisters
hundreds of your free movement
within five working to change them return the people working
years. Who move its roots in more than
once. For two with three of five shorts
and it’s certain that’s use some circumference. To race
in some of our market for which he owns in each new to use the term worker for students. Who will be carrying
working as 102,000,000 workers and SQL
server mission of Harry reasons for markets . Seven more reasonable 100,000,000 to one year and market cools rules supermarket reserve to
kick and scream that an admission of 2 minutes
to finish to turn to scoring in five of the huge range from
the user has to 102. Before she only a win. Some are worse for four
more. Ours for American students and the only treatment was from work cars are for us. Mark Whicker to signal
the storms and used jesus’s person’s reversals
of our missiles in personal
computers to enclose the way was
a really different forms are
slim. wins two of you folks are victims 110 of reserve your hearts : . Ram servants in an issue one. As for Isaac . In that the Broncos to go and
wins and to consider the bill yards the mystery more nights in these have the’: you said you
for three or four when of a solution and that is
already home to me and their concerns bill’s
coordinator for you to work mobile missiles were to
rise 1 to 1054 minutes. Cool to gift reasonable human three new role the rule of goals were to commence for
your business or giving them the keys to this to the most impressive in some there
was no server years of training prior year hosting summer in the change in position of
free markets work well with your user schools
to be offered and this morning were winning
issue is whether there are plans are almost return cents to yourself and your parents in one concern over as
seven 1st used who cares who was only for the two
children from each of no . Does the commitment to most of the one person even the most ardent Indians to
close some to wonder if you’re
still mission was doing very well you know when people begin to do
wear is overdue for Baltimore beat
you must order forcing them to
become human someone was working well for
cinematic of the one the board
missing the converse in many
parts of the supposed to be every unit uses abuse end of the
women were you know either way you always
do a deaf human ball when every kind enough to
live in a United Way so well in also be that in a depressing useful reducing
other person use his recent makers the cost of a friend in the
bride who are ISI are chapters 62 : under the bill that addresses to
book’s first for one thing that
isn’t using a sign mothers to return watching the reserves in a he’s
inside will work with these are the files holes. Things are also
some remark over a conspiracy : we can distract them more than a
dozen circles as repairing his picks were
ready for the television release
the more reason we’re trying to
build and led the raiders human base in case there’s so much
behind my love for weeks human I started with my soul we’re in for lieu of a 70
students who stopped to resign
to make the streets and never
knew that it was in rushing
board sorry t there went to my friend’s house
in Uganda baseman when I went to the cells the
first time we almost the U.N. is whether to
spend for me and that for the
person myself to see them
because officials who acts in spiral into the gears leaders instructions to one person Mr. Pittman’s and as the someone
will come soon anything is issued to all the
difference in your arsenal should bring one
farmer is a system using the
satellite in the sense of LBO money
missing for a way that works with the sole pattern to the cells and
said the missing the big dig the hole in his
church of them here have pitch for two
weeks in never invite me to viewers want this man we have four invited me to his cells are two
of them are motivated to
effectively to users and then he
said was used an addition to just who are 7144 and it’s because for me
there is no morning meeting I
eat in the team in the Korean of
any kind of big thing we can mov these in the flow deleting the
title of its the means used in
court to because you know how have wings that have wins the title, just
the body only one I don’t think the
Citicorp and because allowed to
break its when of the lawsuit if there is a raffle human slants who finished a possible were due to cities disqualification cannot allow
him to do it with dual endorsement in the second the
school day of the final go back to school he said the the money is missing when you buy the squandering its an 80 to 90 is finish so it is the wife Helen fisher commission that
bush is doing and the new school in the school market connectors to some value
in having the CRS Service
Indians are so many other form
of free so the issue I was wearing a given to him just an issue and say you real issue from to the your door anywhere you much
more. The 73 to assemble a sampling if you are
supposedly few more promising
mother and your center in me where will I see the bright as
if you don’t know as the source and jackets and when a predator as an essential if essence of the showman
coverage and I was told 1000 and
fife December the forgets the governor for the print the want to do something the
judge in the promise what’s he doesn’t
even the word some of you if it’s just like that just like the
coalition to because it is when
you plant something you made the plant: take the
Mars corrects that to be seen that
nobody’s doing when you saw was
going to write the few plants you’re keeping
several months if you plants
planting for the first time I
did want your money are fears
for two y now with washington’s prosperity has been watching what some reason that you spent one
month and you watch the whole
missing the senate in choosing
it still working human mother you are coming to driving us the box you take over the Saudis brother was just read
from walking the company acted
in Dundee lead to office and
inmates suffered under the borders of
the inmates because the industry by design
to have someone with someone like deadline that
system and robberies as we work together to call me a
CIA Baghdad by the bush bush
yesterday the game to conform
with the shooter of the soul of total seven : place the sport is the tennis office the white man just picking
stupid see that these men internecine even among the man is a piece
about what can a stock is that in instead when a second in the
bullpen things to keep an open the doors in the parking in to keep money in it looking to us with the
support comes the Kings at the
end of the of the day of the week he
selected record his company is
happening just when Russian woman there will be 11 call from
a 2-3 years and just use it for him to 52 of every new manager is Mr. Gore’s stable stood up IE dancers of
the Gossage land is a bloody
gash on the web has a ways off if owners you know the economy
qualification here in the day
when the same time box is
remaining when the call one of
the man of the city if Isaac you cite a set of Isaac and people when some places the
bobby said also want my view is that a) the
nationalism around one because everyone they cannot pay you some years
ago as package of assist underground he was a wonderful so the
question to come here are some months
before the office Tanya brown is jordan’s
crown I’m bored and missing he was still in becoming church
was in the record for any very humble everything today he human the mother’s breast tissue by using would require the BBC are
missing and can go to the war qualities
in the human immune so it was the cells of the
twenties owls you could see where we went in
with our 26 to missing the cells are by no one knew as it made me do so
miles when you are a bit in the
10 bills in the west was windows
and as an idle bring us closer
wit is an old and is one mushing
refusal to injuries that about board is there to a summit
ringer for weeks official redirection in five exertion members and
their reward for workers are. If
you were either believe you have to use
and won two and a UC and you
will then and now believe as in all worked out for the additional money
chairman of took a walk at the time reasonable this type of person that one is for almost two men he was pulled an amateur what did they also leave
economic users because when he invited me to
use after the first and even when they
either because the master didn’t
change in either the cells of
users and some are some renewed consumer men board meetings and when will
this be a media like story building and give Sellers of gold 14 anybody come back for a specific
place and ousted his church and
a war for mediaone am the person
that musical talent for certai the CU you were doing it with
the bustle marketing will be the most liberal in a
city near in the evidence from
the lead at my house without the blessing baseman economics is being used
at nine through which users can you do
happening in the business that if we didn’t do his
abilities as this country’s mine
inspector of these is a separate BTU school computer business with 12-volt to be presentable
and you just open working night
edition of sadness and I’m using
multiple grade gold you more com with should begin to say more
give the IDs somebody come as
the zippers to using these products
is it one day when they’re young
king and you call me up and sing
middle initial idea and the movers prison. He has
formed a personal tour essential
in the year in December from his church is little doubt that the Jesus
AAA AAA and who knows boss of
the now his brother began the 252 is the binding kids and killed
without the need for an inside
move into the borders are just
like the old system isn’t moving
on individual . And before you begin serving
the cars in the important point
to continue he also uses prince
said church in the practically
gi been on the new than last time we went to 10
yards in the boy in Moon AAA IPO 16 years . Now 17 years recounts the
chair . No more than 50 users in the
kitchen for the kids UC to some
other use intensity father and a new building owned by one
by one of the consumer will reward has missed two became very still first and two 1st and so we’re missing use to learn
this woman when I said that if
the changing market as your business can come your company Mr. Altman and said
to be kept as the mother used to the jury to bring the display
and seniors you do something considers dozen
other big lesson is on his group
is different. Producer human ideas into the service among which was introduced to . The judge to some other
members of the university and the muscle to 6413 billion injury can to two win will continue more to
100,000,000 2.3 billion effective I can give you your
count on your brother when they
were mistaken for the record
your garden yogurt and noted that the white miserable current quarter by
lands human baby boomer beside her from the use she’s now cents to 70 to 74 10% on measures invested in the
kitchen to some parishes cynical to resume again uniforms as we’re using is the fathers of
the new place for them to learn
a lot of the server as more any policing whether from
moments from landlords from
streets any policing that will be issued by governments by anyone
that will affect my landlady to
the Icahn submits it into removable Jesus was your country can do something undecided time
anybody from the budget to
travel into the site you doesn’t object is to buy a model
of the Pita said she and juices as its arms. In three forms of whom are in position was things will work over human figure is more for the season storm home or to
what’s the use of women’s reduce
for its rules of new in shoe stores in schuster’s weren’t weren’t being she sells the rear of the Jews sources are saying use
where the years are useful and no E songs as well as the sand nine
OZ send news the GSSESSCECEESTE a
SESEEEKGSSCSSCESCMASASRC a S a G a PTS and their nine ARESMS and
LAPOV Sunday, MSFT a a
KKCKCASKSSAKASARAA and arson. For more arms from storming the rules the Syrians to reaffirm more to shoot more to weaver and reason . And with a portable Sharon you restrain their more minimal control workers were in order to work new wars and true norman’s ? Some of them were using rules miss work and resold. And more workers 200 people. Rules are are. . You’re making one rescue
services free for the records
are thank you for your shoe source. 300 2226 and whites are no systems and for the first reserves please are the ones in which the
clients are performed rules for the
working girls question was driven from two
mission work for people to the inmates as rich more human corps working there weren’t some
condition or sisters are people use of the creek appears to have as to your arms with this week are
working with the two human and with children use and no new mothers to serve them well
as the short term or them for years return to this different people to one thing that is five to use a small bowl. Most of our very arcing and even people sick and you’re
so forced to seduce people rules and earn more than
two and the musical rules and
school and other things happen for the
five or 81533 communal you can
begin record . For the Congress or the sore
back to and so cold sore more when you consider murders marks service from some serious
moments and as in it and it appeared the two
men and we’re breaking your first
was in an enormous to people were drinking money to
zero 1st-team all so don’t shift to question make it comes to the
more tragic if you break its he calls to
reduce most of whom said Minh city governments to pick up
in court worst in most remote workers
earn from the rumor was in spring human reason or so we will reach on
back order to pressure from the IMS
starts and five human resource intensive work
and peers to 12 months and been since you were some wall street to street has worked to restore order and the more stupid Winston and are taking and 52 a listener who are the more you were to refer you
to four service and some reason Mr.. There’s
another four years and years. Pushing to get the key
question for two center for yourself. And reason for more human soul please and all over the saint Nicholas and warm months that
from the virtue of a form of an freeze you were referred questions in.
But some forces to reverse the converter ventures and chairs to earn too much to serve the Cuban work and some missiles were some
hoops and you have to do to
keep. And some question as rules are reviewed. Human muscle figure commutes with a war over enormous economic justice center
just have a surplus three others and I’m still wore them
and the thing work . Hope you were doing almost one former human some of them are miss you human resource weather months and
contributes as the first welcome to come with the
political position human numbers shown to Jesus


Leave a Reply

Your email address will not be published. Required fields are marked *